PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598097.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 342aa    MW: 38842.3 Da    PI: 4.3555
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598097.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.3e-1953106356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  XP_009598097.1  53 KKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 106
                     56689************************************************9 PP

2HD-ZIP_I/II130.28.5e-4252144193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrls eqvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk+++dalk++ e+L++++e+L +e++e
  XP_009598097.1  52 EKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANFDALKHNYESLKHDNEALLKEIRE 144
                     69*************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-1943110IPR009057Homeodomain-like
PROSITE profilePS5007117.57248108IPR001356Homeobox domain
SMARTSM003896.1E-1851112IPR001356Homeobox domain
PfamPF000464.1E-1653106IPR001356Homeobox domain
CDDcd000861.71E-1653109No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2055115IPR009057Homeodomain-like
PRINTSPR000311.0E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000311.0E-588104IPR000047Helix-turn-helix motif
PfamPF021833.0E-18108148IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MKRPCSSDSL GALMSMCPNT TDEQNHMYST RDFQSMLLDE EGCIEESGHV SEKKRRLSVE  60
QVKALEKNFE VENKLEPERK VKLAQELGLQ PRQVAVWFQN RRARWKTKQL ERDYGVLKAN  120
FDALKHNYES LKHDNEALLK EIRELKSKVY TENGENRGVA VKEEAMESES DDNKVIELSK  180
PNDNDINNNN LLENFEEEED EEEEINFENF NAAAASTNIF GDHFKDGSSD SDSSAILNED  240
SSPNAAAISS SGAFLISTNG NGSGSSKSST SLNFCFQFTE SSSKSNLGDG QKGNNYYQPQ  300
QYVKMEEHNF FNGEESCSTL FTDEQAPTLQ WYCPEDWNWK ES
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00587DAPTransfer from AT5G65310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1016100.0AY101610.1 Nicotiana tabacum homeodomain protein Hfi22 (Hfi22) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598097.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
RefseqXP_016455522.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLQ8L8F91e-169Q8L8F9_TOBAC; Homeodomain protein Hfi22 (Fragment)
STRINGSolyc11g010270.1.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.16e-66homeobox protein 6